PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G080900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 241aa    MW: 26102.7 Da    PI: 8.391
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G080900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-142570248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +W+++Ed  l d v+++G ++W+ I++ ++ gR +k+c++rw ++l
  Sevir.3G080900.1.p 25 TSWSKDEDAVLRDQVRLHGARNWEGISAALP-GRNAKSCRLRWCQHL 70
                        68*****************************.***********9986 PP

2Myb_DNA-binding44.63.4e-1479121347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++T+eEd l v +++ ++++ W+tIar ++ gRt++++k+r +++
  Sevir.3G080900.1.p  79 PFTAEEDALVVACHRVFPNK-WSTIARFLP-GRTDNDIKNRCNTV 121
                         79******************.*********.**********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.3271974IPR017930Myb domain
SuperFamilySSF466891.87E-2622117IPR009057Homeodomain-like
SMARTSM007171.3E-132372IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-172372IPR009057Homeodomain-like
PfamPF002493.7E-132470IPR001005SANT/Myb domain
CDDcd001672.07E-132670No hitNo description
SMARTSM007171.5E-1276124IPR001005SANT/Myb domain
PROSITE profilePS5129416.54476126IPR017930Myb domain
PfamPF002492.5E-1179122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-1679123IPR009057Homeodomain-like
CDDcd001672.33E-1179122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MSAPDDAPGG GSSSAAERPA AMRKTSWSKD EDAVLRDQVR LHGARNWEGI SAALPGRNAK  60
SCRLRWCQHL APGVAAGRPF TAEEDALVVA CHRVFPNKWS TIARFLPGRT DNDIKNRCNT  120
VLRQQLYQQP PPPPLRRRHD GTLPLFPLVP GDVRTSARDG SPVLRRQPPD EAVGEDQSGA  180
CLDLFPLVPG DLINKARNDA CEAAAMDVDV GAGDLLEMRL WPAFTAMAVF RAMVQAVRAP  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-232712610108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987088.14e-80PREDICTED: myb-related protein 308-like
TrEMBLK3ZBV81e-174K3ZBV8_SETIT; Uncharacterized protein
STRINGSi024031m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-30myb domain protein 77